Gene ML0169
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0169, len: 200 aa. Conserved hypothetical protein, highly similar to Rv0966c|Y966_MYCTU|P71544 hypothetical protein from M. tuberculosis (200 aa), Fasta scores: E(): 0, (79.5% identity in 200 aa overlap). Also similar to CAB88834|AL353832 hypothetical protein SCE6.30C from Streptomyces coelicolor (277 aa), Fasta scores: E(): 3.3e-20, (41.0% identity in 205 aa overlap). Previously sequenced as Q9Z5H1|AL035500 (200 aa), Fasta scores: E(): 0, (100.0% identity in 200 aa overlap). |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 234932 | 235534 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0169|ML0169
MSNSAQRDAKGARDEPLRAADTDRIQIAQLLAYAAEQGRLELKDYEDRLAKAYAATTYQELEQLRDDLPGSQVSARRGGNPNPAPSTLLLALMSGFERRGRWNVPRKLTTFSLWGSGVLDLRYADFTSTEVELHAYSVMGVQTILLPPEVNVEISGHGVMGSFDRQVRGQGTPGAPTVKIRGFSLWGGVGIKRKARRPRR
Bibliography
No article yet recorded