Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0966c, (MTCY10D7.08), len: 200 aa. Conserved protein, equivalent to AL035500|MLCL373_12 conserved hypothetical protein from Mycobacterium leprae (200 aa), FASTA scores: opt: 1080, E(): 0, (79.5% identity in 200 aa overlap). Also highly similar to SCE6.30c|CAB88834.1|AL353832 hypothetical protein from Streptomyces coelicolor (277 aa). Some similarity to Rv2862c|MTV007.08 conserved hypothetical protein from Mycobacterium tuberculosis (194 aa), FASTA scores: E(): 3.1e-06, (31.5% identity in 184 aa overlap). Equivalent to AAK45243.1 from Mycobacterium tuberculosis strain CDC1551 (230 aa) but shorter 30 aa. Note that Rv0966c has been shortened since first entry.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10772331077835-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0966c|Rv0966c
MSNSAQRDARNSRDESARASDTDRIQIAQLLAYAAEQGRLQLTDYEDRLARAYAATTYQELDRLRADLPGAAIGPRRGGECNPAPSTLLLALLGGFERRGRWNVPKKLTTFTLWGSGVLDLRYADFTSTEVDIRAYSIMGAQTILLPPEVNVEIHGHRVMGGFDRKVVGEGTRGVPTVRIRGFSLWGDVGIKRKPRKPRK