Gene ML0175
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable two component sensor kinase MprB |
| Comments | ML0175, len: 519 aa. Probable mprB, two component sensor kinase, transmembrane protein (EC 2.7.3.-) (see citation below), highly similar to Rv0982|O53895|AL123456 mprB, two component sensor kinase from M. tuberculosis (504 aa), Fasta scores: E(): 0, (81.0% identity in 521 aa overlap); and similar to many others e.g. COPS_PSESM|Q02541 copS, sensor protein involved in activation of copper resistance from Pseudomonas syringae (487 aa), Fasta scores: E(): 1.2e-18, (27.9% identity in 427 aa overlap). Also similar to ML0774, ML2124 and ML2440 from M. leprae. Previously sequenced as Q9Z5G7|AL035500) (519 aa), Fasta scores: E(): 0, (100.0% identity in 519 aa overlap). Contains hydrophobic, possible membrane-spanning regions. Contains Pfam match to entry PF00672 DUF5, Domain found in bacterial signal proteins. Contains Pfam match to entry PF00512 signal, Histidine kinase. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Regulatory proteins |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 241217 | 242776 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0175|mprB
MVRFAWRRRASLRATSSLSLRWRVMLLAMSMVAMVVVLMAFAVYVVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGHSIYTANQPGQTLPVGTAEKAVIRGELFMSQRTASDQRILAIHLPNDSSLLISKSLRPTEAVMTKLRWVLLIVGSLGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLIASMAPEAPRLPDQEMADLRADVLAQIEELSTLVGDLVDLTRDDAGQVVHEPIDMSEVLYRSLERVRRRRNDIHFDVQAIGWQIYGDAAGLSRAVLNLMDNAAKWSPSGGRVVVTMRQFDPSHVELVVSDYGPGIPPQERRLVFERFYRSTTARSLPGSGLGLAIVKQVVINHGGLLRVEDTAPGVQPPGTSIYVLLPGRPMPVSAYSTLADQDMGEANFQDKIGPAVQVSGKSANFRDSAHVISVDYQSARAR
Bibliography
No article yet recorded
