Gene ML0184
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible ribosomal-protein-alanine acetyltransferase RimJ (acetylating enzyme for N-terminal of ribosomal protein S5) |
| Comments | ML0184, len: 214 aa. Possible rimJ, ribosomal-protein-alanine acetyltransferase (EC 2.3.1.128), highly similar to Rv0995|O05578|AL123456 rimJ, ribosomal-protein-alanine acetyltransferase from M. tuberculosis (203 aa), Fasta scores: E(): 0, (86.0% identity in 200 aa overlap). Similar to RIMJ_ECOLI|P09454 rimJ, ribosomal-protein-alanine acetyltransferase from Escherichia coli (194 aa), Fasta scores: E(): 9.4e-12, (28.0% identity in 189 aa overlap); and to many other acetyltransferases. Previously sequenced as Q9Z5F9|AL035500 (218 aa), Fasta scores: E(): 0, (100.0% identity in 214 aa overlap). Contains Pfam match to entry PF00583 Acetyltransf, Acetyltransferase (GNAT) family. Seems to belong to the acetyltransferase family, rimJ subfamily. |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 249407 | 250051 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0184|rimJ
LRFNARHPGWPSNVGPLRVPAGVIRLRAVRLRDGVQWSRIRLADRAYLEPWEPSTEGDWVVRHSVIAWQVLCSSLRSEARKGRMLPYAIELDGNFCGQLTIGNVTHGALRSAWIGYWVSSSATGGGVATGALALGLDHCFGPVMLHRVEATVRPANVASRAVLAKVGFREEGLLRRYLEVDRAWRDHLLMALTIEEVSGSVTSNLVRAGRASWL
Bibliography
No article yet recorded
