Gene Rv0995
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acetylates the N-terminal alanine of ribosomal protein S5 [catalytic activity: acetyl-CoA + ribosomal-protein L-alanine = CoA + ribosomal-protein N-acetyl-L-alanine]. |
| Product | Ribosomal-protein-alanine acetyltransferase RimJ (acetylating enzyme for N-terminal of ribosomal protein S5) |
| Comments | Rv0995, (MTCI237.09), len: 203 aa. RimJ, ribosomal-protein-alanine acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Equivalent to AL035500|MLCL373_24 probable acyltransferase from Mycobacterium leprae (218 aa), FASTA scores: (86.0% identity in 200 aa overlap). Also similar to others and many acyltransferases e.g. BAB69252.1|AB070946 possible acyltransferase from Streptomyces avermitilis (156 aa); NP_385025.1|NC_003047 probable ribosomal-protein-alanine acetyltransferase from Sinorhizobium meliloti (203 aa); P09454|RIMJ_ECOLI|B1066|Z1703|ECS1444 ribosomal-protein-alanine acetyltransferase from Escherichia coli strains K12 and O157:H7 (194 aa), FASTA scores: opt: 247, E(): 1.5e-10, (26.9% identity in 186 aa overlap). Belongs to the acetyltransferase family, RIMJ subfamily. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1111612 | 1112223 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0995|rimJ
MAVGPLRVSAGVIRLRPVRMRDGVHWSRIRLADRAHLEPWEPSADGEWTVRHTVAAWPAVCSGLRSEARNGRMLPYVIELDGQFCGQLTIGNVTHGALRSAWIGYWVPSAATGGGVATGALALGLDHCFGPVMLHRVEATVRPENAASRAVLAKVGFREEGLLRRYLEVDRAWRDHLLMAITVEEVYGSVASTLVRAGHASWP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
