Gene ML0190c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0190c, len: 205 aa. Conserved hypothetical protein, highly similar to Rv1000c conserved hypothetical protein from M. tuberculosis (205 aa). Also similar to conserved hypothetical proteins in various bacteria e.g. AL357613|AL357613_12 from Streptomyces coelicolor (210 aa), fasta scores: E(): 2.4e-44, (55.1% identity in 205 aa overlap); and AE003963|AE003963_5 from Xylella fastidiosa (200 aa), FASTA scores: E(): 9.7e-14, (39.9% identity in 188 aa overlap). Weak similarity to proteins involved in DNA repair |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 255125 | 255742 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0190c|ML0190c
MCDMLVDVGIAFQGSLFEYHERRQLGDGAFIELRSGWLTDGVELLDTLLSEVPWRIERRRMYDKVVNVPRLVSFHDLTTDDPPHPLLTRLRRRLNDIYAGELGEPFTSVGLCCYRDGSDSIAWHGDTIGRNSSEDTMVAIISLGATRVFALRKRGGGPSLRLPLTHGDLLVMGGSCQRTWEHSVPKTSASTGPRVSIQFRPRNVH
Bibliography
No article yet recorded