Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1000c, len: 205 aa. Conserved hypothetical protein, equivalent to ML0190|NP_301263.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (205 aa). Also highly similar to SC5F8.12c|CAB93740.1|AL357613 hypothetical protein from Streptomyces coelicolor (210 aa), FASTA scores: E(): 2.1e-45, (56.8% identity); 9106290|AAF84108.1|AE003963_5|NP_298588.1|NC_002488 protein described as DNA repair system specific for alkylated DNA from Xylella fastidiosa (200 aa), FASTA scores: E(): 3.4e-14, (38.55% identity); and similar in C-terminus to other hypothetical proteins. Note that replaces original Rv1000 predicted on other strand.
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by Microarray analysis (see Davis et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11165311117148-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1000c|Rv1000c
MCDKLGGVAIAVQGALFEHNERRQLGDGAFIDIRSGWLTGGEELLDALLSTVPWRAERRQMYDRVVDVPRLVSFHDLTIEDPPHPQLARMRRRLNDIYGGELGEPFTTAGLCYYRDGSDSVAWHGDTIGRGSTEDTMVAIVSLGATRVFALRPRGRGPSLRLPLAHGDLLVMGGSCQRTFEHAVPKTSAPTGPRVSIQFRPRDVR