Gene ML0204
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable UDP-glucose 4-epimerase GalE1 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase) |
| Comments | ML0204, len: 319 aa. Probable galE1, UDP-glucose 4-epimerase (EC 5.1.3.2) (see citations below), highly similar to Rv3634c|O06373|AL123456 galE1, UDP-glucose 4-epimerase from M. tuberculosis (314 aa), Fasta scores: E(): 0, (86.1% identity in 309 aa overlap). Similar to other bacterial sugar-nucleotide dehydratases (many putative) e.g. Q9ZGH3|AF079762 desIV, TDP-glucose-4,6-dehydratase from Streptomyces venezuelae (337 aa), Fasta scores: E(): 1.4e-24, (34.3% identity in 321 aa overlap). Previously sequenced as O69544|AL023093 (319 aa), Fasta scores: E(): 0, (100.0% identity in 319 aa overlap). Also similar to ML1964 from M. leprae. Contains Pfam match to entry PF01370 Epimerase, NAD dependent epimerase/dehydratase family. Contains PS00061 Short-chain dehydrogenases/reductases family signature. Belongs to the sugar epimerase family. Note that previously known as rmlB2, a DTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (see third citation). |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 275049 | 276008 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0204|galE1
MYGEPVRALVTGAAGFIGSTLVDRLLADGHTVVGLDNFATGHAANLEHLASTPALAFVEADIVTADLQTILDEHRPEVVFHLAAQIDVRHSVVDPQFDASVNVIGTVRLAEAARHTGVRKIVHTSSGGSIYGTPSQYPTPETVPTDPTSPYAAGKVAGEIYLNTFRHLCGLDCSHIAPANVYGPRQDPYGEAGVVAIFVQALLSDRPTKVFGDGTHTRDYVFVDDVVDAFIKASGDAGGGQRFNIGTGIETSDRQLHTAVSAAVGGPDDPEFHPPRLGDLKRSCLDIGLATTVLGWSPQVQLDDGVRRTVEYFRAAQRS
Bibliography
No article yet recorded