Gene Rv3634c (rmlB2)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in galactofuranosyl biosynthesis: converts UDO-GlcP to UDP-GalP [catalytic activity: UDP-glucopyranose = UDP-galactopyranose]. |
| Product | UDP-glucose 4-epimerase GalE1 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase) |
| Comments | Rv3634c, (MTCY15C10.18), len: 314 aa. GalE1, UDP-glucose 4-epimerase (see citations below), equivalent to O69544|ML0204|RMLB2|MLCB2548.27c putative sugar dehydratase (putative sugar-nucleotide dehydratase) from Mycobacterium leprae (319 aa), FASTA scores: opt: 1798, E(): 8.2e-100, (86.4% identity in 309 aa overlap). Also similar to other UDP-glucose 4-epimerases e.g. Q9WYX9|TM0509 from Thermotoga maritima (309 aa) FASTA scores: opt: 877, E(): 4.8e-45, (45.8% identity in 308 aa overlap); Q57664|GALE_METJA|MJ0211 from Methanococcus jannaschii (305 aa), FASTA scores: opt: 792, E(): 5.4e-40, (42.05% identity in 309 aa overlap); Q9K6S7|BH3649 from Bacillus halodurans (311 aa), FASTA scores: opt: 723, E(): 7e-36, (40.5% identity in 316 aa overlap); Q9HSV1|GALE2|VNG0063G from Halobacterium sp. strain NRC-1 (328 aa), FASTA scores: opt: 597, E(): 2.3e-28, (36.35% identity in 322 aa overlap); etc. Contains short-chain alcohol dehydrogenase family signature (PS00061) but this maynot be significant. Belongs to the sugar epimerase family. Note that previously known as rmlB2, a dTDP-glucose 4,6-dehydratase (see Ma et al., 2001). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (see Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h of starvation (see Betts et al., 2002). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4072667 | 4073611 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3634c|galE1
VRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTADLHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVRKIVHTSSGGSIYGTPPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSADVGGGLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAERVLGWRPQIELADGVRRTVEYFRHKHTD
Bibliography
- Weston A et al. [1997]. Biosynthetic origin of mycobacterial cell wall galactofuranosyl residues. Homolog Product Biochemistry Function
- Belanger AE and Inamine JM [2000]. Review
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Ma Y, Stern RJ, Scherman MS, Vissa VD, Yan W, Jones VC, Zhang F, Franzblau SG, Lewis WH and McNeil MR [2001]. Drug targeting Mycobacterium tuberculosis cell wall synthesis: genetics of dTDP-rhamnose synthetic enzymes and development of a microtiter plate-based screen for inhibitors of conversion of dTDP-glucose to dTDP-rhamnose. Secondary Function
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Fontán PA et al. [2008]. Mycobacterium tuberculosis sigma factor E regulon modulates the host inflammatory response. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant