Gene ML0205c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | ML0205c, len: 356 aa. Probable conserved integral membrane protein, highly similar to Rv3629c|O06378|AL123456 conserved integral membrane protein from M. tuberculosis (365 aa), Fasta scores: E(): 0, (66.2% identity in 361 aa overlap). Similar to other bacterial hypothetical membrane proteins e.g. CAB92842|AL356892 putative integral membrane protein SCC8A.24C from Streptomyces coelicolor (380 aa), Fasta scores: E(): 1e-21, (47.5% identity in 377 aa overlap). Previously sequenced as O69543|AL023093 (356 aa), Fasta scores: E(): 0, (100.0% identity in 356 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 276707 | 277777 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0205c|ML0205c
MAAFRGFGISLLTTAIALLVAYIYGGLASLLPLIVLAIFEVSLSFDNAIINAAILKQMSRFWRKMFLTIGILIAAFGMRLIFPAVIVWATAKLDPVRTMDLALHPPPNHALEFPDGSPSYQKLIMSAHPQIAAFGGTFLLMLFLDFVFQDRDIKWLKWIEAPFTRIGRLGPLSVVAIFVLVLIATALTHSGDERAKVLIAGLLSLVTYLLVSVLNRAFRPPDIDTASGRRMAGRAGLVRFLYLEILDATFSFDGVTGAFAITSDPVIIALGLGLISSVFIRSITIYLVHQDALDRYVYLEYGAHWAIGALSVMMLLSVEPRFEILEAVTALVGVLFIGAALTWSVFRNHREVKACT
Bibliography
No article yet recorded
