Gene Rv3629c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv3629c, (MTCY15C10.23), len: 365 aa. Probable conserved integral membrane protein, equivalent to O69543|MLCB2548.26|ML0205 putative membrane protein from Mycobacterium leprae (356 aa), FASTA scores: opt: 1547, E(): 3e-89, (66.2% identity in 361 aa overlap). Also similar to other membrane and hypothetical proteins e.g. CAC37534|SCIF3.15c putative integral membrane protein from Streptomyces coelicolor (363 aa), FASTA scores: opt: 819, E(): 7.7e-44, (51.55% identity in 351 aa overlap); Q9CGK3|YKJK hypothetical protein from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (339 aa) FASTA scores: opt: 683, E(): 2.2e-35, (48.3% identity in 350 aa overlap); Q9KY24|SCC8A.24c putative integral membrane protein from Streptomyces coelicolor (380 aa) FASTA scores: opt: 528, E(): 1.1e-25, (50.25% identity in 372 aa overlap); Q9RJH8|SCF73.09 putative integral membrane protein from Streptomyces coelicolor (370 aa) FASTA scores: opt: 439, E(): 3.9e-20, (50.2% identity in 384 aa overlap); Q9PE36|XF1192 integral membrane protein from Xylella fastidiosa (341 aa), FASTA scores: opt: 337, E(): 8.3e-14, (47.65% identity in 361 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4067957 | 4069054 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3629c|Rv3629c
MSTFRIFGFSLLMTVVALVTGYLHGGPTALFLLAVLALLEVSLSFDNAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHDRDIKWLKWIEVPFARIGRLGQVPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIYLVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESVRRNRLTVRSPTKFGS
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
