Gene ML0234
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Lsr2 protein precursor (15 kDa antigen)(A15) |
| Comments | ML0234, len: 112 aa. lsr2, highly similar to Rv3597c|LSR2_MYCTU|O06285 lsr2, probable lsr protein from M. tuberculosis (112 aa), Fasta scores: E(): 0, (92.9% identity in 112 aa overlap). Homologues also occur in Streptomyces coelicolor e.g. Q9X8N1|AL049628 putative lsr2-like protein SCE94.26C (111 aa), Fasta scores: E(): 7.3e-18, (56.3% identity in 112 aa overlap). |
| Functional category | Cell wall and cell processes, Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 305368 | 305706 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0234|lsr2
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQWVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAFHAAT
Bibliography
No article yet recorded