Gene Rv3597c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Dominant T-cell antigen and possibly stimulates lymphoproliferation. Has DNA-bridging activity. |
| Product | Iron-regulated H-NS-like protein Lsr2 |
| Comments | Rv3597c, (MTCY07H7B.25), len: 112 aa. Lsr2, H-NS-like protein, identical to P24094|LSR2_MYCLE|ML0234 LSR2 protein precursor (15 KDA antigen) (A15) from Mycobacterium leprae (112 aa), FASTA scores: opt: 698, E(): 6.7e-37, (92.85% identity in 112 aa overlap). Also highly similar to others e.g. Q9X8N1|SCE94.26c from Streptomyces coelicolor (111 aa), FASTA scores: opt: 379, E(): 4.4e-17, (58.05% identity in 112 aa overlap); Q9ETI2|LSR2 from Corynebacterium equii (Rhodococcus equi) (119 aa), FASTA scores: opt: 328, E(): 6.9e-14, (47.5% identity in 120 aa overlap); and Q9RKK8|SCD25.12c from Streptomyces coelicolor (105 aa), FASTA scores: opt: 293, E(): 9.4e-12, (47.75% identity in 111 aa overlap). |
| Functional category | Information pathways |
| Proteomics | Identified by proteomics (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the aqueous phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis: up-regulated at high temperatures (see Stewart et al., 2002), and up-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain and no virulence modification seen in SCID mice (see McAdam et al., 2002). Quantitative PCR shows INH-mediated induction of iniB|Rv0341, iniA|Rv0342 and iniC|Rv0343 is repressed in M. tuberculosis H37Rv overexpressing lsr2|Rv3597c (See Colangeli et al., 2007). M. tuberculosis H37Rv overexpressing lsr2|Rv3597c is more resistant to H2O2 (See Colangeli et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4040981 | 4041319 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3597c|lsr2
MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT
Bibliography
- Wong DK, Lee BY, Horwitz MA and Gibson BW [1999]. Identification of fur, aconitase, and other proteins expressed by Mycobacterium tuberculosis under conditions of low and high concentrations of iron by combined two-dimensional gel electrophoresis and mass spectrometry. Proteomics Regulation
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Oftung F et al. [2000]. Extensive sequence homology between the mycobacterium leprae LSR (12 kDa) antigen and its Mycobacterium tuberculosis counterpart. Homology
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- McAdam RA, Quan S, Smith DA, Bardarov S, Betts JC, Cook FC, Hooker EU, Lewis AP, Woollard P, Everett MJ, Lukey PT, Bancroft GJ, Jacobs Jr WR and Duncan K [2002]. Characterization of a Mycobacterium tuberculosis H37Rv transposon library reveals insertions in 351 ORFs and mutants with altered virulence. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Colangeli R et al. [2007]. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. Biochemistry Mutant
- Chen JM et al. [2008]. Lsr2 of Mycobacterium tuberculosis is a DNA-bridging protein. Function
- Gordon BR et al. [2008]. Lsr2 of Mycobacterium represents a novel class of H-NS-like proteins. Function Product
- Colangeli R et al. [2009]. The multifunctional histone-like protein Lsr2 protects mycobacteria against reactive oxygen intermediates. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant