Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionDominant T-cell antigen and possibly stimulates lymphoproliferation. Has DNA-bridging activity.
ProductIron-regulated H-NS-like protein Lsr2
CommentsRv3597c, (MTCY07H7B.25), len: 112 aa. Lsr2, H-NS-like protein, identical to P24094|LSR2_MYCLE|ML0234 LSR2 protein precursor (15 KDA antigen) (A15) from Mycobacterium leprae (112 aa), FASTA scores: opt: 698, E(): 6.7e-37, (92.85% identity in 112 aa overlap). Also highly similar to others e.g. Q9X8N1|SCE94.26c from Streptomyces coelicolor (111 aa), FASTA scores: opt: 379, E(): 4.4e-17, (58.05% identity in 112 aa overlap); Q9ETI2|LSR2 from Corynebacterium equii (Rhodococcus equi) (119 aa), FASTA scores: opt: 328, E(): 6.9e-14, (47.5% identity in 120 aa overlap); and Q9RKK8|SCD25.12c from Streptomyces coelicolor (105 aa), FASTA scores: opt: 293, E(): 9.4e-12, (47.75% identity in 111 aa overlap).
Functional categoryInformation pathways
ProteomicsIdentified by proteomics (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the aqueous phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: up-regulated at high temperatures (see Stewart et al., 2002), and up-regulated after 24h of starvation (see Betts et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain and no virulence modification seen in SCID mice (see McAdam et al., 2002). Quantitative PCR shows INH-mediated induction of iniB|Rv0341, iniA|Rv0342 and iniC|Rv0343 is repressed in M. tuberculosis H37Rv overexpressing lsr2|Rv3597c (See Colangeli et al., 2007). M. tuberculosis H37Rv overexpressing lsr2|Rv3597c is more resistant to H2O2 (See Colangeli et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40409814041319-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3597c|lsr2
MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT
      
Bibliography