Gene ML0242
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Thought to be involved in deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the fourth step). Catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol. [Catalytic activity: ATP + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol = ADP + 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol]. |
| Product | Probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) |
| Comments | ML0242, len: 311 aa. Probable ispE, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.-), highly similar to Rv1011|IPK_MYCTU|O05596 ispE, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase from M. tuberculosis (306 aa), Fasta scores: E(): 0, (87.5% identity in 303 aa overlap). Similar to many e.g. IPK_ECOLI|P24209 Escherichia coli isopentenyl monophosphate kinase (283 aa), Fasta scores: E(): 1.3e-13, (35.6% identity in 202 aa overlap). Belongs to the IspE family. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 317042 | 317977 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0242|ispE
MPTGSVTVQVPGKINLYLAVGDCCDNGYHELVTVFHAVSLVDQVTVRNADVLSLGLVGEGANHVPTDEHNIAWRAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELSLPRRDLCMLAAKLGSDVPFALHGGTALGTGRGEELATVLSRATFHWVLAFADSSLLTPAVYTEFDRLRDVGNPPRLAEPGPVLAALVAADPEQLAPLLGNELQAAAVSLDPALRCALRAGMEAGALAGIVSGSGPTCAFLCASATSAIDVGAQLAGAGVCRTVRVATGPVPGARVVHAPMSRGLNDM
Bibliography
No article yet recorded