Gene ML0245c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable 50S ribosomal protein L25 RplY |
| Comments | ML0245c, len: 215 aa. Probable rplY, 50s ribosomal protein L25, highly similar to Rv1015c|RL25_MYCTU|P96385 rplY, 50S ribosomal protein L25 from M. tuberculosis (215 aa), Fasta scores: E(): 0, (73.9% identity in 218 aa overlap). Similar to many others e.g. RL25_ECOLI|P02426 rplY, 50S ribosomal protein L25 from Escherichia coli (94 aa), Fasta scores: E(): 0.00054, (33.7% identity in 89 aa overlap). Contains Pfam match to entry PF01386 Ribosomal_L25p, Ribosomal L25p family. Belongs to the L25P family of ribosomal proteins. |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 320577 | 321224 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0245c|rplY
MAKSTVNKLSVSVRTNTGKGASRRARRDGKVPAVLYGHGEEPQHLELPAHAFSAVLRHVGTNAVLTLEVAGKEQLALTKAIDVHPIRHTIMHADLLVVRSGEKIVVEVPVEVEGDAGPDILVTQETTSIEIEAEALSIPEQLTMSIEGAEPGTQFTARQIPLPVGVTLVSDPEMLVVNVVNAPTDAQTKAKYAGEAHEAPEVGTAENKTAATESE
Bibliography
No article yet recorded