Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionBinds to the 50S rRNA
Product50S ribosomal protein L25 RplY
CommentsRv1015c, (MTCY10G2.34), len: 215 aa. rplY, 50s ribosomal protein L25, similar to RL25_ECOLI|P02426 50s ribosomal protein L25 from Escherichia coli (94 aa), FASTA scores: opt: 182, E(): 2.5e-05, (38.4% identity in 86 aa overlap) and to CTC_BACSU|P14194 general stress protein from Bacillus subtilis (203 aa), FASTA scores: opt: 260, E(): 1.4e-09, (28.4% identity in 201 aa overlap). Belongs to the L25P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11339211134568-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1015c|rplY
MAKSASNQLRVTVRTETGKGASRRARRAGKIPAVLYGHGAEPQHLELPGHDYAAVLRHSGTNAVLTLDIAGKEQLALTKALHIHPIRRTIQHADLLVVRRGEKVVVEVSVVVEGQAGPDTLVTQETNSIEIEAEALSIPEQLTVSIEGAEPGTQLTAGQIALPAGVSLISDPDLLVVNVVKAPTAEELEGEVAGAEEAEEAAVEAGEAEAAGESE