Gene ML0287
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved transmembrane protein |
Comments | ML0287, len: 222 aa. Possible conserved transmembrane protein, highly similar to Rv0364|Y364_MYCTU|O06314 conserved transmembrane protein from M. tuberculosis (227 aa), Fasta scores: E(): 0, (66.1% identity in 227 aa overlap). Similar to many dedA-family proteins e.g. Q9X8J1|AL049841 possible membrane protein SCE9.18C from Streptomyces coelicolor (303 aa), Fasta scores: E(): 0, (42.8% identity in 201 aa overlap). Previously sequenced as O69601|AL023514 (222 aa), Fasta scores: E(): 0, (100.0% identity in 222 aa overlap). Contains hydrophobic, possible membrane-spanning regions. Contains Pfam match to entry PF00597 DedA, DedA family. Belongs to the DedA family. |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 368449 | 369117 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0287|ML0287 MNTAIVALPPTLDPMFWIGPEGFFAAAMLPATLVIIFVETGLLFPLLPGESLLFTGGLLATKGTIDIWVLSPSVAVVAVLGDQIGYLIGRRIGPALFKKENSRFFKQHYVTESHAFFEKHGRWTIILARFLPFMRTFTPVIAGLSYMSYPLYLGFDIVGGILWGGGVTVAGYFLGNVPFVRQNLEKIILGILFVSLLPALIAAWHGYRSQSRTAKSELALPD
Bibliography
No article yet recorded