Gene Rv0364
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | Rv0364, (MTCY13E10.26), len: 227 aa. Possible conserved transmembrane protein, equivalent to O69601|Y364_MYCLE|ML0287|CAA18951.1|AL023514|AL023514|MLCB4_19 hypothetical 24.3 KDA protein from Mycobacterium leprae (222 aa), FASTA scores: opt: 1027, E(): 0, (66.1% identity in 227 aa overlap). Shows strong similarity to DEDA_ECOLI|P09548 DedA protein protein from Escherichia coli FASTA scores: E(): 1.3e-28, (39.5% identity in 195 aa overlap). Similar also to Mycobacterium tuberculosis DedA protein Rv2637|MTCY441.0. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 442395 | 443078 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0364|Rv0364
MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFPLLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDSRFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGVAWGAGVTLAGYFLGSVPFVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDPLVLPE
Bibliography
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant