Gene ML0295
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable phosphomethylpyrimidine kinase ThiD |
| Comments | ML0295, len: 279 aa. Probable thiD, phosphomethylpyrimidine kinase (EC 2.7.4.7), highly similar to Rv0422c|THID_MYCTU|P96268 thiD, phosphomethylpyrimidine kinase from M. tuberculosis (265 aa), Fasta scores: E(): 0, (77.8% identity in 266 aa overlap). Similar to many others e.g. THID_ECOLI|P76422 thiD, phosphomethylpyrimidine kinase from Escherichia coli (266 aa), Fasta scores: E(): 3.2e-29, (38.4% identity in 263 aa overlap). Previously sequenced as THID_MYCLE|Q9ZBL1 (279 aa), Fasta scores: E(): 0, (99.6% identity in 279 aa overlap). Belongs to the ThiD family. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 379127 | 379966 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0295|thiD
VNYLPAPPPGTTPLRVLSIAGSDSGGGAGIQADMRTMTVLGVHACTAVTAVTIQNTLGVEGFHEIPAEIVASQIKAVVTDIGIQSAKTGMLASSSIIAAVAETWLRLELTTPLVVDPVCASMHGDPLLTGEAMDSLRDRLFPLATVVTPNLDEVRLLVGIDVVDTESQRAAAMALHALGPQWALVKGGHLRSSDRSCDLLYGGSSAGVAFHEFDAPRVQTGNDHGGGDTLAAAVSCALAHGYTVPDAVGFGKRWVTECLRDAYPLGRGHGPVSPLFQRT
Bibliography
No article yet recorded