Gene Rv0422c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in thiamine biosynthesis. Catalyzes the phosphorylation of HMP-P to HMP-pp [catalytic activity: ATP + 4-amino-2-methyl-5-phosphomethylpyrimidine = ADP + 4-amino-2-methyl-5-diphosphomethylpyrimidine]. |
Product | Probable phosphomethylpyrimidine kinase ThiD (HMP-phosphate kinase) (HMP-P kinase) |
Comments | Rv0422c, (MTCY22G10.19c), len: 265 aa. Probable thiD, phosphomethylpyrimidine kinase, equivalent to AL035159|MLCB1450_21 phosphomethylpyrimidine kinase from Mycobacterium leprae (279 aa), FASTA scores: opt: 1386, E(): 0, (77.8% identity in 266 aa overlap). Also highly similar to others e.g. HIU32725_3|P44697|THID_HAEIN phosphomethylpyrimidine kinase from Haemophilus influenzae (269 aa), FASTA scores: opt: 605, E(): 0, (42.1% identity in 259 aa overlap). Belongs to the ThiD family. |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 507758 | 508555 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0422c|thiD MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQNTLGVKDIHEVPNDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLVVDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAKALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAAALAHGFTVPDAVDFGKRWVTECLRAAYPLGRGHGPVSPLFRLS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant