Gene ML0297c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable thiamine biosynthesis protein ThiG (Thiazole biosynthesis protein) |
| Comments | ML0297c, len: 261 aa. Probable thiG, thiamine biosynthesis protein, highly similar to Rv0417|P96263|AL123456 thiG, thiamine biosynthesis protein from M. tuberculosis (252 aa), Fasta scores: E(): 0, (86.8% identity in 250 aa overlap). Similar to many proteins involved in the biosynthesis of the thiazole moiety of thiamine e.g. THIG_ECOLI|P30139 thiG, thiamine biosynthetic protein (thiazole moiety) from Escherichia coli (281 aa), Fasta scores: E(): 0, (51.2% identity in 244 aa overlap). Previously sequenced as Q9ZBL2|AL035159 (261 aa), Fasta scores: E(): 0, (99.6% identity in 261 aa overlap). Belongs to the thiG family. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 380645 | 381430 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0297c|thiG
VVESKFTIGDRTFTSRLIMGTGGAANLAILEEALIASGTELTTVAIRRVDTDGGSGLLKLLSRLDIMPLPNTAGCRSAAEAVLTAQLAREALNTNWIKLEVIADERTLLPDGLELVRAAEQLVDAGFVVLPYTNDDPALAHRLEGTGCAAVMPLGSPIGTGLGINNPHNIEIIVAQARVPVVLDAGIGTTSDAALAMELGCDAVLLASAVTRAVDPPTMAAAMASAVTAGYLARRAGRIPKRFWAQASSPELMRTGEELGN
Bibliography
No article yet recorded
