Gene ML0298c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible protein ThiS |
| Comments | ML0298c, len: 74 aa. Possible thiS protein, highly similar to Rv0416|P96262|AL123456 Possible thiS protein from M. tuberculosis (68 aa), Fasta scores: E(): 5.9e-17, (71.6% identity in 74 aa overlap). Shows some similarity to other bacterial thiS proteins e.g. THIS_ECOLI|O32583 thiS, hypothetical protein from Escherichia coli (66 aa), Fasta scores: E(): 0.41, (32.0% identity in 50 aa overlap). Previously sequenced as Q9ZBL3|AL035159 (74 aa), Fasta scores: E(): 1.2e-28, (100.0% identity in 74 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 381423 | 381647 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0298c|thiS
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKISELPAVTGRSEPIRLEVVTAVQGG
Bibliography
No article yet recorded