Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in thiamine biosynthesis.
ProductPossible protein ThiS
CommentsRv0416, (MTCY22G10.13), len: 68 aa. Possible thiS protein, equivalent to T44740|4154055|CAA22709.1|AL035159|MLCB1450.25 hypothetical protein from Mycobacterium leprae (74 aa), FASTA scores: opt: 303, E(): 2e-18, (71.6% identity in 74 aa overlap). Shows weak similarity with O32583|THIS_ECOLI|THIG1|B3991.1 this protein from Escherichia coli strain K12 (66 aa), FASTA scores: opt: 103, E(): 0.052, (30.9% identity in 68 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryIntermediary metabolism and respiration
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS502167502373+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0416|thiS
MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLEVVTAVQGG