Gene Rv0416 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Possibly involved in thiamine biosynthesis. | 
| Product | Possible protein ThiS | 
| Comments | Rv0416, (MTCY22G10.13), len: 68 aa. Possible thiS protein, equivalent to T44740|4154055|CAA22709.1|AL035159|MLCB1450.25 hypothetical protein from Mycobacterium leprae (74 aa), FASTA scores: opt: 303, E(): 2e-18, (71.6% identity in 74 aa overlap). Shows weak similarity with O32583|THIS_ECOLI|THIG1|B3991.1 this protein from Escherichia coli strain K12 (66 aa), FASTA scores: opt: 103, E(): 0.052, (30.9% identity in 68 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). | 
| Functional category | Intermediary metabolism and respiration | 
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 502167 | 502373 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv0416|thiS
MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLEVVTAVQGG
      
    Bibliography
    - Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant