Gene ML0311c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable phosphatidylserine decarboxylase Psd |
| Comments | ML0311c, len: 243 aa. Probable psd, phosphatidylserine decarboxylase (EC 4.1.1.65), highly similar to Rv0437c|O86324|AL123456 psd, possible phosphatidylserine decarboxylase from M. tuberculosis (231 aa), Fasta scores: E(): 0, (72.6% identity in 241 aa overlap). Similar to some other phosphatidylserine decarboxylases e.g. AAF41369|AE002447 phosphatidylserine decarboxylase precursor-related protein from Neisseria meningitidis (265 aa), Fasta scores: E(): 2.5e-23, (39.2% identity in 217 aa overlap); and Q92IU5 Phosphatidylserine decarboxylase from Rickettsia conorii (231 aa). Previously sequenced as Q9ZBM3|AL035159 (202 aa), Fasta scores: E(): 0, (99.5% identity in 202 aa overlap). The start codon is uncertain. Codon usage suggests an alternative start at codon 63 (approx). Contains Pfam match to entry to PF02666 PS_Dcarbxylase, Phosphatidylserine decarboxylase. Belongs to the phosphatidylserine decarboxylases family. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 397946 | 398677 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0311c|psd
VARRPRAESSKEGPAHLLELVRSAVPPVHSAGHPFISAGLAVTSAGAVGQVVTGRDLRWLRRVGLLAASACAVFFRHPSRVPPTRAGVVVAPADGMICVIDSATPPAELSMGNMSLPRVSIFLSLLDVHVQRAPISGEVIAVQYQPGRFGAADLAPASTENERTSVRIRTAGGTEVVVVQIAGLLARRIVCYAHIGDKLTIGDTYGLIRFGSRLDTYLPPGTEPVVQVGQRAVAGETVLADLT
Bibliography
No article yet recorded
