Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, but involved in lipid metabolism [catalytic activity: phosphatidyl-L-serine = phosphatidylethanolamine + CO(2)].
ProductPossible phosphatidylserine decarboxylase Psd (PS decarboxylase)
CommentsRv0437c, (MTV037.01c), len: 231 aa (start uncertain). Possible psd, phosphatidylserine decarboxylase , equivalent to CAC29819.1|AL583918 conserved hypothetical protein from Mycobacterium leprae (243 aa); and highly similar to MLCB1450.11|T44729|4154044|CAA22695.1|AL035159 hypothetical protein from Mycobacterium leprae (202 aa), FASTA score: (74.6% identity in 197 aa overlap). Also similar to other phosphatidylserine decarboxylases e.g. NP_108058.1|14027249|BAB54203.1|AP003012 phosphatidylserine decarboxylase from Mesorhizobium loti (232 aa); AAK86872|g15156090|AGR_C_1963 phosphatidylserine decarboxylase from Agrobacterium tumefaciens (244 aa); AAG12422.1|AY005137|Psd phosphatidylserine decarboxylase from Chlorobium tepidum (216 aa); etc.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS525387526082-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0437c|psd
VARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRYRWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPLPRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVAGETVLAECR