Gene Rv0437c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but involved in lipid metabolism [catalytic activity: phosphatidyl-L-serine = phosphatidylethanolamine + CO(2)]. |
| Product | Possible phosphatidylserine decarboxylase Psd (PS decarboxylase) |
| Comments | Rv0437c, (MTV037.01c), len: 231 aa (start uncertain). Possible psd, phosphatidylserine decarboxylase , equivalent to CAC29819.1|AL583918 conserved hypothetical protein from Mycobacterium leprae (243 aa); and highly similar to MLCB1450.11|T44729|4154044|CAA22695.1|AL035159 hypothetical protein from Mycobacterium leprae (202 aa), FASTA score: (74.6% identity in 197 aa overlap). Also similar to other phosphatidylserine decarboxylases e.g. NP_108058.1|14027249|BAB54203.1|AP003012 phosphatidylserine decarboxylase from Mesorhizobium loti (232 aa); AAK86872|g15156090|AGR_C_1963 phosphatidylserine decarboxylase from Agrobacterium tumefaciens (244 aa); AAG12422.1|AY005137|Psd phosphatidylserine decarboxylase from Chlorobium tepidum (216 aa); etc. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 525387 | 526082 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0437c|psd
VARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRYRWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPLPRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVAGETVLAECR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant