Gene ML0320
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible transcription factor |
Comments | ML0320, len: 165 aa. Possible transcriptional factor, highly similar to Rv3583c|O53568|AL123456 possible transcription factor from M. tuberculosis (162 aa), Fasta scores: E(): 0, (97.5% identity in 162 aa overlap). Similar to many putative bacterial transcription factors e.g. Q9L0Q9|SCD8A.05 putative transcriptional factor regulator from Streptomyces coelicolor A3(2) (160 aa), and weak similarity to Q50887|Z56280 carD, transcription factor from Myxococcus xanthus (316 aa), Fasta scores: E(): 9.1e-13, (31.2% identity in 154 aa overlap). |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 410355 | 410852 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0320|ML0320 LNLMIFKVGDTVVYPHHGAALVEAIETRTINGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDQVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVSEVVRDLWRRDQDRGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS
Bibliography
No article yet recorded