Gene ML0320
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible transcription factor |
| Comments | ML0320, len: 165 aa. Possible transcriptional factor, highly similar to Rv3583c|O53568|AL123456 possible transcription factor from M. tuberculosis (162 aa), Fasta scores: E(): 0, (97.5% identity in 162 aa overlap). Similar to many putative bacterial transcription factors e.g. Q9L0Q9|SCD8A.05 putative transcriptional factor regulator from Streptomyces coelicolor A3(2) (160 aa), and weak similarity to Q50887|Z56280 carD, transcription factor from Myxococcus xanthus (316 aa), Fasta scores: E(): 9.1e-13, (31.2% identity in 154 aa overlap). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 410355 | 410852 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0320|ML0320
LNLMIFKVGDTVVYPHHGAALVEAIETRTINGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDQVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVSEVVRDLWRRDQDRGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS
Bibliography
No article yet recorded