Gene Rv3583c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Possible transcription factor |
| Comments | Rv3583c, (MTV024.01c, MTCY06G11.30c), len: 162 aa. Possible transcriptional factor, identical to Q9CCW7|ML0320 putative transcription factor from Mycobacterium leprae (165 aa), FASTA scores: opt: 1004, E(): 6.1e-56, (97.55% identity in 162 aa overlap); and Q9ZBM8|MLCB1450.01c putative transcriptional regulator from Mycobacterium leprae (94 aa), FASTA scores: opt: 600, E(): 6e-31, (97.85% identity in 94 aa overlap). Also highly similar to others e.g. Q9L0Q9|SCD8A.05 from Streptomyces coelicolor (160 aa), FASTA scores: opt: 878, E(): 4.3e-48, (85.0% identity in 160 aa overlap); Q9K600|BH3935 from Bacillus halodurans (153 aa) FASTA scores: opt: 383, E(): 3.1e-17, (36.4% identity in 151 aa overlap); Q9KD36|BH1383 from Bacillus halodurans (164 aa) FASTA scores: opt: 305, E(): 2.4e-12, (33.55% identity in 164 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4025056 | 4025544 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3583c|Rv3583c
MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS
Bibliography
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
