Gene ML0377
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Conserved hypothetical protein |
Comments | ML0377, len: 161 aa. Conserved hypothetical protein, highly similar to Rv3422c|YY22_MYCTU|Q50706 conserved hypothetical protein from M. tuberculosis (168 aa), Fasta scores: E(): 0, (77.4% identity in 146 aa overlap). Similar to many other bacterial hypothetical proteins e.g. O86788|YJEE_STRCO|SC6G4.25 from Streptomyces coelicolor (148 aa), Fasta scores: E(): 0, (48.3% identity in 120 aa overlap). Previously sequenced as YY22_MYCLE|Q49864 (161 aa), Fasta scores: E(): 0, (100.0% identity in 161 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 470283 | 470768 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0377|ML0377 MAEYSLRSGAVICERVEDTVALGSRLGEQLRAGDVVVLSGPLGAGKTVLAKGIAVAMDVDGPVISPTYVLARVHLPRRLGTPAMIHVDVYRLLDHRDADLVGELDSLDLDTDLAEAVVVMEWGAGLAECLAARHLDIRLERVRYSDVRIATWQWVCSRDRP
Bibliography
No article yet recorded