Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3422c, (MTCY78.07), len: 168 aa. Conserved hypothetical protein, equivalent to Q49864|YY22_MYCLE|ML0377|U229F|B229_C2_205 hypothetical 17.6 KDA protein from Mycobacterium leprae (161 aa), FASTA scores: opt: 752, E(): 8.3e-38, (77.4% identity in 146 aa overlap). Also similar to other hypothetical bacterial proteins e.g. O86788|YJEE_STRCO|SC6G4.25 from Streptomyces coelicolor (148 aa), FASTA scores: opt: 377, E(): 1.2e-15, (50.85% identity in 120 aa overlap); Q9X1W7|TM1632 from Thermotoga maritima (161 aa), FASTA scores: opt: 247, E(): 6.2e-08, (39.4% identity in 137 aa overlap); Q9RRY1|DR2351 from Deinococcus radiodurans (148 aa), FASTA scores: opt: 236, E(): 2.6e-07, (38.6% identity in 127 aa overlap); etc. Contains PS00017 ATP /GTP-binding site motif A.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38396913840197-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3422c|Rv3422c
LSREGIRRRPKARAGLTGGGTATLPRVEDTLTLGSRLGEQLCAGDVVVLSGPLGAGKTVLAKGIAMAMDVEGPITSPTFVLARMHRPRRPGTPAMVHVDVYRLLDHNSADLLSELDSLDLDTDLEDAVVVVEWGEGLAERLSQRHLDVRLERVSHSDTRIATWSWGRS