Gene Rv3422c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3422c, (MTCY78.07), len: 168 aa. Conserved hypothetical protein, equivalent to Q49864|YY22_MYCLE|ML0377|U229F|B229_C2_205 hypothetical 17.6 KDA protein from Mycobacterium leprae (161 aa), FASTA scores: opt: 752, E(): 8.3e-38, (77.4% identity in 146 aa overlap). Also similar to other hypothetical bacterial proteins e.g. O86788|YJEE_STRCO|SC6G4.25 from Streptomyces coelicolor (148 aa), FASTA scores: opt: 377, E(): 1.2e-15, (50.85% identity in 120 aa overlap); Q9X1W7|TM1632 from Thermotoga maritima (161 aa), FASTA scores: opt: 247, E(): 6.2e-08, (39.4% identity in 137 aa overlap); Q9RRY1|DR2351 from Deinococcus radiodurans (148 aa), FASTA scores: opt: 236, E(): 2.6e-07, (38.6% identity in 127 aa overlap); etc. Contains PS00017 ATP /GTP-binding site motif A. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3839691 | 3840197 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3422c|Rv3422c
LSREGIRRRPKARAGLTGGGTATLPRVEDTLTLGSRLGEQLCAGDVVVLSGPLGAGKTVLAKGIAMAMDVEGPITSPTFVLARMHRPRRPGTPAMVHVDVYRLLDHNSADLLSELDSLDLDTDLEDAVVVVEWGEGLAERLSQRHLDVRLERVSHSDTRIATWSWGRS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant