Gene ML0382c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable transcriptional regulatory protein WhiB-like WhiB3 |
Comments | ML0382c, len: 102 aa. Probable whiB3 (alternate gene name: whmB), WhiB-like regulatory protein (see citations below), highly similar to Rv3416|Q50710|AL123456 whiB3, WhiB-like regulatory protein from M. tuberculosis (102 aa), Fasta scores: E(): 0, (86.3% identity in 102 aa overlap). Similar to many e.g. O88103|AJ010601 whiD, developmental regulatory gene from Streptomyces coelicolor (112 aa), Fasta scores: E(): 1.1e-24, (61.8% identity in 102 aa overlap). Previously sequenced as Q49871|U00015 (102 aa), Fasta scores: E(): 0, (100.0% identity in 102 aa overlap). Also similar to ML0760, ML0804 and ML2307 from M.leprae. Contains Pfam entry to PF02467, Transcription factor WhiB. |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 475772 | 476080 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0382c|whiB3 MPQPKQLPGPNATIWNWQLQGLCRGVDSSMFFHPDGERGRARMQREQRAKEMCRRCPVIEECRAHALDVGEPYGVWGGLSESERDLLLKGDLARSRSIPRSA
Bibliography
No article yet recorded