Gene Rv3416 (whmB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism (growth phase-dependent). |
| Product | Transcriptional regulatory protein WhiB-like WhiB3. Contains [4FE-4S] cluster. |
| Comments | Rv3416, (MTCY78.13c), len: 102 aa. WhiB3 (alternate gene name: whmB), WhiB-like regulatory protein (see citations below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Equivalent to Q49871|WHIB3|WHIB|ML0382|B229_F1_2|B1620_F3_137 probable transcription factor WHIB3 from Mycobacterium leprae (102 aa), FASTA scores: opt: 657, E(): 7.9e-39, (86.25% identity in 102 aa overlap). Also highly similar to Q9Z6E9|WHIB3 from Mycobacterium smegmatis (96 aa), FASTA scores: opt: 604, E(): 3.5e-35, (80.4% identity in 102 aa overlap); and O88103|WHID|SC6G4.45c|WBLB from Streptomyces coelicolor (112 aa), FASTA scores: opt: 437, E(): 1.4e-23, (62.5% identity in 96 aa overlap). Also similar to O05847|WHIB1|Rv3219|MTCY07D11.07c from Mycobacterium tuberculosis (84 aa), FASTA scores: opt: 215, E(): 2.5e-08, (44.45% identity in 81 aa overlap). Note that primer extension analysis revealed three transcriptional start sites and that expression from the three potential promoters is growth phase-dependent (see Mulder et al., 1999). Moreover, the transcription of this CDS seems to be activated in macrophages (see Ramakrishnan et al., 2000). [4Fe-4S] cluster is degraded by oxygen and reacts with no (See Singh et al., 2007). |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv mutant has enhanced growth on acetate medium; impaired growth on medium with glucose, pyruvate, succinate, fumarate (See Singh et al., 2007). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3834892 | 3835200 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3416|whiB3
MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRRTA
Bibliography
- Mulder NJ et al. [1999]. Characterization of a Mycobacterium tuberculosis homologue of the Streptomyces coelicolor whiB gene. Regulation
- Hutter B and Dick T [1999]. Molecular genetic characterisation of whiB3, a mycobacterial homologue of a Streptomyces sporulation factor. Homolog Mutant
- Ramakrishnan L et al. [2000]. Granuloma-specific expression of Mycobacterium virulence proteins from the glycine-rich PE-PGRS family. Homolog Regulation
- Steyn AJ et al. [2002]. Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Secondary Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Singh A et al. [2007]. Mycobacterium tuberculosis WhiB3 responds to O2 and nitric oxide via its [4Fe-4S] cluster and is essential for nutrient starvation survival. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
