Gene ML0424c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable bacterioferritin comigratory protein Bcp |
| Comments | ML0424c, len: 161 aa. Probable bcp, bacterioferritin comigratory protein, highly similar to Rv2521|O5322|AL123456 bcp, bacterioferritin comigratory protein from M. tuberculosis (157 aa), Fasta scores: E(): 0, (79.6% identity in 157 aa overlap). Similar to many members of the AhpC/TSA family, suggesting a protective, antioxidant role. e.g. shows similarity to BAA90524|AB037598 prxQ, peroxiredoxin Q from Sedum lineare (186 aa), Fasta scores: E(): 3e-17, (40.0% identity in 155 aa overlap); P23480|BCP_ECOLI|B2480|BAB36765|Z3739|ECS3342 BACTERIOFERRITIN COMIGRATORY PROTEIN from Escherichia coli strain K12 (156 aa). Previously sequenced as O07705|Z97179 (161 aa), Fasta scores: E(): 0, (99.4% identity in 161 aa overlap). Contains Pfam match to entry PF00578 AhpC-TSA, AhpC/TSA family. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 523804 | 524289 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0424c|bcp
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCTKQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDCKVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAKLRRDLSLLECC
Bibliography
No article yet recorded