Gene Rv2521
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Putative antioxidant protein. |
| Product | Probable bacterioferritin comigratory protein Bcp |
| Comments | Rv2521, (MTV009.06), len: 157 aa. Probable bcp, bacterioferritin comigratory protein, equivalent to O07705|BCP|ML0424 from Mycobacterium leprae (161 aa), FASTA scores: opt: 829, E(): 6.8e-46, (79.6% identity in 157 aa overlap). Also highly similar to Q9KZQ2|SCE6.38 hypothetical 16.8 KDA protein Streptomyces coelicolor (155 aa), FASTA scores: opt: 727, E(): 2e-39, (69.5% identity in 154 aa overlap); P23480|AAG57590|BCP_ECOLI|B2480|BAB36765|Z3739|ECS3342 bacterioferritin comigratory protein from Escherichia coli strain K12 (156 aa), FASTA scores: opt: 513, E(): 8.3e-26, (48.3% identity in 149 aa overlap); Q9RW23|DR0846 bacterioferritin comigratory protein from Deinococcus radiodurans (175 aa), FASTA scores: opt: 465, E(): 1e-22, (46.5% identity in 157 aa overlap); P44411|BCP_HAEIN|HI0254 bacterioferritin comigratory protein from Haemophilus influenzae (155 aa), FASTA scores: opt: 453, E(): 5.3e-22, (47.5% identity in 139 aa overlap); etc. Also similar to Mycobacterium tuberculosis Rv1608c|MTV046.06|bcpB and Rv2238c|MTCY427.19c|hpE. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2837684 | 2838157 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2521|bcp
VTKTTRLTPGDKAPAFTLPDADGNNVSLADYRGRRVIVYFYPAASTPGCTKQACDFRDNLGDFTTAGLNVVGISPDKPEKLATFRDAQGLTFPLLSDPDREVLTAWGAYGEKQMYGKTVQGVIRSTFVVDEDGKIVVAQYNVKATGHVAKLRRDLSV
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
