Gene ML0430
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane leucine and alanine rich protein |
| Comments | ML0430, len: 454 aa. Probable conserved integral membrane leu-, ala-rich protein, highly similar to Rv2508c|O06171|AL123456 conserved integral membrane from M. tuberculosis (445 aa), Fasta scores: E(): 0, (75.7% identity in 441 aa overlap). Also similar to hypothetical or membrane proteins e.g. Q9RKX9|AL133213|SC6D7.19C putative integral membrane protein from Streptomyces coelicolor (486 aa), Fasta scores: E(): 1.5e-13, (29.7% identity in 445 aa overlap). Previously sequenced as O07710|Z97179 (464 aa), Fasta scores: E(): 0, (100.0% identity in 454 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 529521 | 530885 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0430|ML0430
MNQPESVAGTMVRSWVVAWAMWDCGSTGLTAIVATFVFSVYLTSSVGVGMPDGISLVSWLGRAGAVAGLTIAVLAPAIGVWVESPHRRRVTLGVLTVLAVALTCGMSFIRDQPSYLWAGLMLLAGTAACGDLASVPYNAMLRQLSTPATAGRISGLGWASGYVGSVVLLLLIYLGFISGTGELRGLLQLPTHDGIYVRAAMLLAAAWLALLALPLLLTAHRLPSLGEVSHPTSMLGGYRKLWSEVSAEWRRDRNLVYFLVASALFRDGLAATLGFGAVLGVNAYGISQANVLMFGVVASLVAAVGAVLGGFVDHRIGSKRVIVGSLVAIIVTALTLMTLSGPLAFWVCGLVLCLFIGPSQSSSRALLLHMAKHGREGVAFGLYTMTGRAASFVAPWSFSIFVDGFGVVRAGLGGISVVLLAGLLGMLMVRVPTRREAAAVGLSWWRSQARRGQV
Bibliography
No article yet recorded