Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane leucine and alanine rich protein
CommentsRv2508c, (MTCY07A7.14c), len: 445 aa. Probable conserved integral membrane leu-, ala-rich protein, equivalent to Q9CCU4|ML0430 putative membrane protein from Mycobacterium leprae (454 aa) (alias O07710|MLCL383.37 longer 10 aa), FASTA scores: opt: 2205, E(): 2.5e-124, (75.75% identity in 441 aa overlap). Also similar to hypothetical or membrane proteins e.g. BAB50841|MLL4103 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (458 aa), FASTA scores: opt: 396, E(): 2.4e-16, (27.75% identity in 447 aa overlap); Q9RKX9|SC6D7.19c putative integral membrane protein from Streptomyces coelicolor (486 aa), FASTA scores: opt: 323, E(): 5.7e-12, (28.95% identity in 428 aa overlap); P42306|YXIO_BACSU probable integral membrane protein from Bacillus subtilis (428 aa), FASTA scores: opt: 220, E(): 7.2e-06, (20.35% identity in 413 aa overlap); etc. Also similar to proteins from Mycobacterium tuberculosis e.g. Q10564|Y876_MYCTU|Rv0876c|MT0899|MTCY31.04c (548 aa), FASTA scores: opt: 184, E(): 0.0012, (24.7% identity in 466 aa overlap).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28232562824593-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2508c|Rv2508c
MNNPGSRAGTLLHFRVVAWAMWDCGSTGLNAIVTTFVFSVYLTSAVGQGLPGGTSPASWLGRAGAVAGLTIGVLAPVVGVWVESPHRRRVALSVLTGTAVALTCAMFLIRDDPRYLWAGLVLLAATAASSDLSSVPYNAMLRQLSTPSTAGRISGFGWASGYVGSVALLLVIYLGFMSGSGSQRGLLQLPVANGLNVRMAMLVAAAWLALLGLPLLLVAHRLPDSGAASHPSTGLLGGYRKLWTEISAEWRRDRNLVYFLVASAIFRDGLAAIFAFGAVLGVNAYGLTQADVLIFGAAASVVAAVGAVLGGFVDHRIGSKPVIVGSLAAIIAAALTLLTLSGPTAFWACGLLLCVFIGPAQSSARALLLHMAQHGKEGVAFGLYTMTGRAVSFLGPWLFSVFVDVFHTVRAGLGGVCLVLTTGLLLMLRVQVSRHGGALTTAQSS