Gene ML0452c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable alpha-mannosyltransferase PimA |
| Comments | ML0452c, len: 374 aa. Probable pimA, alpha-mannosyltransferase (EC 2.4.1.-), highly similar to Rv2610c|O06204|AL123456 pimA, alpha-mannosyltransferase from M. tuberculosis (378 aa), Fasta scores: E(): 0, (82.3% identity in 378 aa overlap). N-terminus is highly similar to Q9FY7 putative alpha-mannosyl transferase (fragment) from Mycobacterium smegmatis (27 aa) (see citation below). Also highly similar to Q9L284|SCL2.15c putative sugar transferase from Streptomyces coelicolor (387 aa), FASTA scores: opt: 1222, E(): 1.8e-67, (52.95% identity in 376 aa overlap); and similar in part to various proteins e.g. Q9R6U1|U45308 sqdX, required for biosynthesis of the sulfolipid sulfoquinovosyldiacylglycerol from Synechococcus sp. (377 aa), Fasta scores: E(): 6.9e-12, (25.9% identity in 390 aa overlap) and to CDS from the Bordetella parapertussis ipopolysaccharide biosynthesis locus e.g. O52848|AJ224768 wlbH, putative glcNac transferase (390 aa), Fasta scores: E(): 6.1e-12, (27.3% identity in 392 aa overlap). Previously sequenced as O07147|Z96801 (374 aa), Fasta scores: E(): 0, (100.0% identity in 374 aa overlap). Shows weak similarity to ML0886, ML1715 and ML2443 from M. leprae. Contains Pfam match to entry PF00534 Glycos_transf_1, Glycosyl transferases group 1. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 552241 | 553365 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0452c|ML0452c
MRIGMICPYSFDVPGGVQSHVLQLAEVMRARGQQVRVLAPASPDVSLPEYVVSAGRAIPIPYNGSVARLQFSPAVHSRVRRWLVDGDFDVLHLHEPNAPSLSMWALRVAEGPIVATFHTSTTKSLTLSVFQGVLRPWHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVNVDSLSSAPQLAGYPRLGKTVLFLGRYDEPRKGMSVLLDALPGVMECFDDVQLLIVGRGDEEQLRSQAGGLVEHIRFLGQVDDAGKAAAMRSADVYCAPNIGGESFGIVLVEAMAAGTPVVASDLDAFRRVLRDGEVGHLVPAGDSAALADALVALLRNDVLRERYVAAGAEAVRRYDWSVVASQIMRVYETVATSGSKVQVAS
Bibliography
No article yet recorded
