Gene Rv2610c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the first mannosylation step in phosphatidylinositol mannoside biosynthesis (transfer of mannose residues onto PI, leading to the synthesis of phosphatidylinositol monomannoside). |
| Product | Alpha-mannosyltransferase PimA |
| Comments | Rv2610c, (MTCY01A10.23), len: 378 aa. PimA, alpha-mannosyltransferase (see citations below), equivalent to O07147|MLCL581.14c|ML0452 putative glycosyltransferase from Mycobacterium leprae (374 aa), FASTA scores: opt: 2044, E(): 8.8e-118, (82.25% identity in 378 aa overlap). N-terminus (from aa 1 to 27) equivalent to Q9FY7 putative alpha-mannosyl transferase (fragment) from Mycobacterium smegmatis (27 aa), blastp scores: 57.4 bits (137), E(): 3e-8, Identities = 25/27 (92%), Positives = 27/27 (99%) (see citation below). Also highly similar to Q9L284|SCL2.15c putative sugar transferase from Streptomyces coelicolor (387 aa), FASTA scores: opt: 1222, E(): 1.8e-67, (52.95% identity in 376 aa overlap); and similar in part to various proteins e.g. Q9YA73|APE2066 long hypothetical N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein from Aeropyrum pernix (392 aa), FASTA scores: opt: 434, E(): 3e-19, (31.5% identity in 378 aa overlap); Q9UZA1|PAB0827 galactosyltransferase or LPS biosynthesis RFBU related protein from Pyrococcus abyssi (371 aa), FASTA scores: opt: 382, E(): 4.3e-16, (28.2% identity in 383 aa overlap); O26275|MTH173 LPS biosynthesis RFBU related protein from Methanothermobacter thermautotrophicus (382 aa), FASTA scores: opt: 372, E(): 1.8e-15, (28.4% identity in 391 aa overlap); etc. Shows also some similarity with O05313|Rv1212c|MTCI364.24c hypothetical 41.5 KDA protein from Mycobacterium tuberculosis (387 aa), FASTA scores: opt: 232, E(): 1.1e -07, (28.4% identity in 402 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Lipid metabolism |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2937865 | 2939001 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2610c|pimA
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS
Bibliography
- Jackson M et al. [2000]. Phosphatidylinositol is an essential phospholipid of mycobacteria. Homolog Function
- Korduláková J et al. [2002]. Definition of the first mannosylation step in phosphatidylinositol mannoside synthesis. PimA is essential for growth of mycobacteria. Product Biochemistry Mutant Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
