Gene ML0455c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0455c, len: 206 aa. Conserved hypothetical protein, highly similar to Rv2613c|O06201|AL123456 conserved hypothetical protein from M. tuberculosis (195 aa), Fasta scores: E(): 0, (84.7% identity in 196 aa overlap). Similar to many HIT-family hypothetical proteins e.g. Q9L279|SCL2.20 from Streptomyces coelicolor (186 aa), Fasta scores: E(): 0, (84.7% identity in 196 aa overlap); and Q9F7Z0 from Mycobacterium smegmatis (see citation below) (205 aa). Previously sequenced as O07150|Z96801 (186 aa), Fasta scores: E(): 0, (100.0% identity in 186 aa overlap). Contains Pfam match to entry PF01230 HIT, HIT family. In M. tuberculosis it seems the Rv2613c and downstream ORF Rv2612c|psgA1 are expressed from the same promoter (see citation below) and that Rv2613c should be involved in lipid metabolism. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 555050 | 555670 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0455c|ML0455c
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDNSTPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVSELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEHLHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGDDAERSL
Bibliography
No article yet recorded
