Gene ML0475
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0475, len: 251 aa. Conserved hypothetical protein, highly similar to YQ03_MYCTU|O33214|Rv2603c Conserved hypothetical protein from M. tuberculosis (251 aa), Fasta scores: E(): 0, (92.4% identity in 251 aa overlap). Similar to many bacterial hypothetical proteins e.g. Q9L288|SCL2.11c HYPOTHETICAL 26.8 KDA PROTEIN from Streptomyces coelicolor (250 aa), FASTA scores: E(): 2.6e-73, (75.502% identity in 249 aa overlap); and Q9AE12|YFCA HYPOTHETICAL STRUCTURAL PROTEIN from Corynebacterium glutamicum (Brevibacterium flavum) (251 aa), faasta scores: E(): 5.6e-70, (71.315% identity in 251 aa overlap). Previously sequenced as YQ03_MYCLE|Q49645 (251 aa), Fasta scores: E(): 0, (100.0% identity in 251 aa overlap). Contains Pfam match to entry PF01709 DUF28, Domain of unknown function. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 576362 | 577117 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0475|ML0475
MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLYDAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLIECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTEDDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEASFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDGE
Bibliography
No article yet recorded
