Gene Rv2603c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Highly conserved protein |
| Comments | Rv2603c, (MTCI270A.02), len: 251 aa. Highly conserved protein, equivalent to Q49645|YQ03_MYCLE|ML0475|U1177B|B1177_C2_181 hypothetical 26.6 KDA protein from Mycobacterium leprae (251 aa), FASTA scores: opt: 1514, E(): 2.2e-84, (92.45% identity in 251 aa overlap). Also highly similar to Q9L288|SCL2.11c hypothetical 26.8 KDA protein from Streptomyces coelicolor (250 aa), FASTA scores: opt: 1268, E(): 1.5e-69, (76.7% identity in 249 aa overlap); Q9AE12|YFCA hypothetical structural protein from Corynebacterium glutamicum (Brevibacterium flavum) (251 aa), FASTA scores: opt: 1231, E(): 2.6e-67, (72.9% identity in 251 aa overlap); O83487|Y474_TREPA|TP0474 hypothetical protein from Treponema pallidum (245 aa), FASTA scores: opt: 780, E(): 4.4e-40, (47.75% identity in 245 aa overlap); P24237|YEBC_ECOLI|B1864 protein YEBC from Escherichia coli strain K12 (246 aa), FASTA scores: opt: 776, E(): 7.6e-40, (47.8% identity in 249 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2930805 | 2931560 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2603c|Rv2603c
MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTIMYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKGVVTLEKNGLTEDDVLAAVLEAGAEDVNDLGDSFEVISEPAELVAVRSALQDAGIDYESAEASFQPSVSVPVDLDGARKVFKLVDALEDSDDVQNVWTNVDVSDEVLAALDDE
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gao LY et al. [2003]. Transposon mutagenesis of Mycobacterium marinum identifies a locus linking pigmentation and intracellular survival. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant