Gene ML0486 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable conserved membrane protein secretion factor YajC | 
| Comments | ML0486, len: 114 aa. Probable yajC, a conserved membrane protein secretion factor, (see Braunstein & Belisle 2000), highly similar to YP88_MYCTU|Q50633|Rv2588c Probable yajC, secretion factor from M. tuberculosis (115 aa), Fasta scores: E(): 7e-29, (77.0% identity in 100 aa overlap); and CAD94804|Mb2619c from M. bovis (115 aa). Similar to other bacterial proteins e.g. Q9L292|SCL2.07c putative secreted protein from Streptomyces coelicolor (169 aa), Fasta scores: E(): 7.3e-08, (35.8% identity in 120 aa overlap). Previously sequenced as YP88_MYCLE|Q49647 (114 aa), Fasta scores: E(): 0, (100.0% identity in 114 aa overlap). Contains a possible N-terminal signal sequence. | 
| Functional category | Cell wall and cell processes | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 589653 | 589997 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML0486|yajC
MESLVLLLLFLLIMGGFMFFASRRQRRSMQATIDLYNSLQPGDRVNTTSGLQATIIVVGDDTVDLEIAPGVVTTWMKLAIRDRILPDDAYMDEHEAEPGDFVYCDELEESDGSS
      
    Bibliography
    No article yet recorded