Gene ML0486
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved membrane protein secretion factor YajC |
| Comments | ML0486, len: 114 aa. Probable yajC, a conserved membrane protein secretion factor, (see Braunstein & Belisle 2000), highly similar to YP88_MYCTU|Q50633|Rv2588c Probable yajC, secretion factor from M. tuberculosis (115 aa), Fasta scores: E(): 7e-29, (77.0% identity in 100 aa overlap); and CAD94804|Mb2619c from M. bovis (115 aa). Similar to other bacterial proteins e.g. Q9L292|SCL2.07c putative secreted protein from Streptomyces coelicolor (169 aa), Fasta scores: E(): 7.3e-08, (35.8% identity in 120 aa overlap). Previously sequenced as YP88_MYCLE|Q49647 (114 aa), Fasta scores: E(): 0, (100.0% identity in 114 aa overlap). Contains a possible N-terminal signal sequence. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 589653 | 589997 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0486|yajC
MESLVLLLLFLLIMGGFMFFASRRQRRSMQATIDLYNSLQPGDRVNTTSGLQATIIVVGDDTVDLEIAPGVVTTWMKLAIRDRILPDDAYMDEHEAEPGDFVYCDELEESDGSS
Bibliography
No article yet recorded