Gene Rv2588c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in secretion apparatus. |
| Product | Probable conserved membrane protein secretion factor YajC |
| Comments | Rv2588c, (MTCY227.13), len: 115 aa. Probable yajC, secretion factor, a conserved membrane protein (see Braunstein & Belisle 2000), equivalent to Q49647|YP88_MYCLE|ML0486|MLCB1259.04|B1177_C3_235 hypothetical 12.8 KDA protein from Mycobacterium leprae (114 aa), FASTA scores: opt: 499, E(): 2.7e-26, (77.0% identity in 100 aa overlap). Also similar to other proteins e.g. Q9AE08 hypothetical 13.5 KDA protein from Corynebacterium glutamicum (Brevibacterium flavum) (121 aa), FASTA scores: opt: 222, E(): 5e-08, (39.8% identity in 103 aa overlap); Q9L292|SCL2.07c putative secreted protein from Streptomyces coelicolor (169 aa), FASTA scores: opt: 203, E(): 1.2e-06, (32.05% identity in 106 aa overlap); Q9CDT0|YWAB unknown protein from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (110 aa), FASTA scores: opt: 150, E(): 0.0026, (30.85% identity in 94 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2915846 | 2916193 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2588c|yajC
MESFVLFLPFLLIMGGFMYFASRRQRRAMQATIDLHDSLQPGERVHTTSGLEATIVAIADDTIDLEIAPGVVTTWMKLAIRDRILPDDDIDEELNEDLDKDVDDVAGERRVTNDS
Bibliography
- Braunstein M and Belisle JT [2000]. Review
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
