Gene ML0494
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable histidyl-tRNA synthase HisS (Histidine--tRNA ligase) (HisRS) (Histidine--Translase) |
| Comments | ML0494, len: 427 aa. Probable hisS, histidyl-tRNA synthetase (EC 6.1.1.21), highly similar to SYH_MYCTU|Q50641|Rv2580c hisS, histidyl-tRNA synthase from M. tuberculosis (423 aa), Fasta scores: E(): 9.9e-145, (85.9% identity in 417 aa overlap); and CAD94796|Mb2611c from M. bovis (423 aa). Also highly similar to many e.g. Q9KXP2|HISS from Streptomyces coelicolor (425 aa), FASTA scores: ; SYH_ECOLI|P04804 hisS, histidyl-tRNA synthase from Escherichia coli (423 aa), Fasta scores: (42.1% identity in 413 aa overlap). Previously sequenced as SYH_MYCLE|P46696 (427 aa), Fasta scores: E(): 0, (99.5% identity in 427 aa overlap). Contains Pfam match to entry PF00587 tRNA-synt_2b, tRNA synthetase class II (G, H, P, S and T). Contains PS00017 ATP/GTP-binding site motif A (P-loop). Contains PS00211 ABC transporters family signature. Belongs to the class-II aminoacyl-tRNA synthetase family. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 599741 | 601024 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0494|hisS
VTESCTVFSFSGPKGIPDYFPPDSAQFVAVRDGLLTAARRAGYGDIELPVFEDTALFARGVGESTDVVAKEMYTFADRGDRSVTLRPEGTAGVVRAVIEHGLDRGALPVKLCYAGPFFRYERPQAGRCRQLQQVGVEAIGVDDPALDAEVITIADAGFRSLGLDGFQLEITSLGDGTCRPQYRKLLQEFLLQLDLDEDTRRRAELNPLRVLDDKRPQVQAMTAAAPVLLDHLSDGAKQHFDTVLAHLDALRVPYVINPRMVRGLDYYTKTTFEFVHPGLGAQSGIGGGGRYDGLMRQLGGQDLSGIGFGLGVDRTLLALHAEGKTVGETTRCDVFGVSLGEAAKLKVAMLAGQLRAAGVRVDLIYGDRGIRGAMRAAGRSGARIALIVDDCAIKADGVGVRDLATGEQISVAVDSVVAEVISRIAPS
Bibliography
No article yet recorded
