Gene Rv2580c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechamism [catalytic activity: ATP + L-histidine + tRNA(his) = AMP + pyrophosphate + L-histidyl-tRNA(his)]. |
| Product | Probable histidyl-tRNA synthetase HisS (histidine--tRNA ligase) (HISRS) (histidine--translase) |
| Comments | Rv2580c, (MT2657, MTCY227.21), len: 423 aa. Probable hisS, histidyl-tRNA synthetase, equivalent to P46696|SYH_MYCLE|hiss|ML0494|MLCB1259.12|B1177_C3_248 histidyl-tRNA synthetase from Mycobacterium leprae (427 aa), FASTA scores: opt: 2380, E(): 2.1e-131, (85.85% identity in 417 aa overlap). Also highly similar to many e.g. Q9KXP2|hiss from Streptomyces coelicolor (425 aa), FASTA scores: opt: 1542, E(): 1.4e-82, (56.0% identity in 418 aa overlap); O32422|SYH_STAAU|hiss from Staphylococcus aureus (420 aa), FASTA scores: opt: 1135, E(): 7.4e-59, (44.9% identity in 412 aa overlap); P04804|SYH_ECOLI|hiss|B2514 from Escherichia coli strain K12 (423 aa), FASTA scores: opt: 1099, E(): 9.4e-57, (43.9% identity in 417 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to class-II aminoacyl-tRNA synthetase family. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2904821 | 2906092 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2580c|hisS
VTEFSSFSAPKGVPDYVPPDSAQFVAVRDGLLAAARQAGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVVRAVIEHGLDRGALPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAIADAGFRSLGLDGFRLEITSLGDESCRPQYRELLQEFLFGLDLDEDTRRRAGINPLRVLDDKRPELRAMTASAPVLLDHLSDVAKQHFDTVLAHLDALGVPYVINPRMVRGLDYYTKTAFEFVHDGLGAQSGIGGGGRYDGLMHQLGGQDLSGIGFGLGVDRTVLALRAEGKTAGDSARCDVFGVPLGEAAKLRLAVLAGRLRAAGVRVDLAYGDRGLKGAMRAAARSGARVALVAGDRDIEAGTVAVKDLTTGEQVSVSMDSVVAEVISRLAG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
