Gene ML0542
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable DNA-directed RNA polymerase omega chain RpoZ (Transcriptase omega chain) (RNA polymerase omega subunit) |
| Comments | ML0542, len: 110 aa. Probable rpoZ, DNA-directed RNA polymerase omega chain (EC 2.7.7.6), highly similar to YD90_MYCTU|P71660|Rv1390 rpoZ, DNA-directed RNA polymerase omega chain from M. tuberculosis (110 aa), Fasta scores: E(): 0, (90.0% identity in 110 aa overlap); and CAD94286|Mb1425 from M. bovis (110 aa). Also similar to Q9KXS1|RPOZ_STRCO Probable DNA-directed RNA polymermerase omega chain from Streptomyces coelicolor (90 aa), fasta scores: E(): 8.4e-19, (71.250% identity in 80 aa overlap). Subunit: CONSISTS OF A SIGMA FACTOR AND THE RNAP CORE ENZYME WHICH IS COMPOSED OF 2 ALPHA CHAINS, 1 BETA CHAIN, 1 BETA' CHAIN AND 1 OMEGA CHAIN. Belongs to the RNA polymerase omega chain family. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 657981 | 658313 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0542|rpoZ
VSIPQSNTSLSAVIAVDQFDPSSGGQGVYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDHYNQLGEGILEYVGPLVEPGLQEKPLSIAMREIHADLLEHTEGE
Bibliography
No article yet recorded