Gene ML0543
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable DNA/pantothenate metabolism flavoprotein homolog Dfp |
Comments | ML0543, len: 419 aa. Probable dfp, DNA/pantothenate metabolism flavoprotein homolog, highly similar to DFP_MYCTU|P71661|Rv1391 probable dfp, DNA/pantothenate metabolism flavoprotein homolog from M. tuberculosis (418 aa), Fasta scores: E(): 1.8e-139, (87.0% identity in 409 aa overlap); and CAD94287|Mb1426 from M. bovis (418 aa). Similar to many e.g. DFP_ECOLI|P24285 dfp, DNA/pantothenate metabolism flavoprotein from Escherichia coli (430 aa), Fasta scores: E(): 0, (39.7% identity in 408 aa overlap). Contains match to Pfam entry PF02441 Flavoprotein. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 658334 | 659593 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0543|dfp MDCKRVVVGVSGGIAAYKACTVVRQLIDAGHEVRVIPTESALRFVGTATFEALSGQPVYTDVFDDIPAVSHVYLGKQADLVVVAPATADLLARAVHGRADDLLTATLLTARCPIMFAPAMHTEMWLHPATVDNVATLRRRGAIVLEPASGRLTGTDSGAGRLPEAEEITTLAQLLLERHDALPYDLTGRKLLVTSGGTRESIDPVRFIGNRSSGKQGYAVARVAVQRGAEVTLIAGHTAGLTNPAGVDVVHVGSAQQLGDAVSKHAPDFDVLVMAAAVADFRPAQVATAKIKKGPDDQDEPLIELVYNEDVLAAAVRARTHGQLPNMRAIVGFAAETGDASGDVLFHARAKLRRKGCDLLVVNAVGDGRAFEVDNNDGWLLASDGTELALQHGSKMLMASRIVDGIVTFLHGLPDLRGG
Bibliography
No article yet recorded