Gene Rv1391
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Flavoprotein affecting synthesis of DNA and pantothenate metabolism |
Product | Probable DNA/pantothenate metabolism flavoprotein homolog Dfp |
Comments | Rv1391, (MTCY21B4.08), len: 418 aa. Probable dfp, DNA/pantothenate metabolism flavoprotein homolog, similar to many e.g. DFP_ECOLI|P24285 Escherichia coli (430 aa), FASTA scores: opt: 763, E(): 0, (40.2% identity in 408 aa overlap). |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1565441 | 1566697 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv1391|1565441-1566697|+|dfp|downstream:0|upstream:0 gtggtggaccataaacggatccccaagcaggtaatagtcggtgtctccgggggcatcgccgcctacaaggcgtgcacggttgttcgtcaactcaccgaggccagtcatcgcgtccgagtcattcccaccgaatccgccctgcgcttcgtcggtgccgcgaccttcgaggcgctctccggtgagccggtgtgcaccgacgttttcgccgacgttccggcggtcccgcatgttcacctcggccagcaggccgatctggtcgtagtggcgccggccaccgccgacctgctggcccgcgcggcggccggtcgagccgacgatctgctgaccgcgacgctgctgacggcgcggtgtccggtgctgttcgcgccggcgatgcacaccgagatgtggttgcatccggccaccgtcgacaacgtggccacgctgcgccgccgcggcgcggtggtgctcgagcccgcgacaggacggcttaccggcgccgacagcggggccggccgactgcccgaggcggaggagatcaccaccctcgcccagctgctgctggagcggcacgacgccctgccctacgatctcgcggggcgaaagctgctggttaccgccggtggcacacgcgagccgatcgatccggtgcgctttatcggcaaccgcagctccggcaagcagggctatgcggtggcgcgggtggccgcccagcgcggcgccgacgttactttgatcgctgggcataccgcagggctcgtcgatcccgccggcgtcgaggtggtgcacgtcagctcggcccagcaactcgccgacgcggtgtccaagcacgctccgaccgccgacgtattggtgatggcggcggccgtcgccgacttccggcccgcgcaggttgccaccgccaaaatcaagaaaggcgtcgaaggcccaccgaccatcgagctgctgcgcaacgacgacgtgctggccggggtggtgcgggcccgagcccatggacaactgcccaacatgcgggccattgtgggcttcgcagccgagaccggcgacgccaatggcgacgtgctctttcatgcccgagctaaactgcgacgcaaaggctgcgatctgttagtcgtcaatgccgtcggcgaaggcagggcctttgaggtagacagcaacgacggctggctactggcgtccgatggtaccgagtcggcattgcagcacggctccaagacactgatggcgagccgtatcgttgatgcaatcgtcacgttcctggcaggctgtagcagctaa
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1391|dfp VVDHKRIPKQVIVGVSGGIAAYKACTVVRQLTEASHRVRVIPTESALRFVGAATFEALSGEPVCTDVFADVPAVPHVHLGQQADLVVVAPATADLLARAAAGRADDLLTATLLTARCPVLFAPAMHTEMWLHPATVDNVATLRRRGAVVLEPATGRLTGADSGAGRLPEAEEITTLAQLLLERHDALPYDLAGRKLLVTAGGTREPIDPVRFIGNRSSGKQGYAVARVAAQRGADVTLIAGHTAGLVDPAGVEVVHVSSAQQLADAVSKHAPTADVLVMAAAVADFRPAQVATAKIKKGVEGPPTIELLRNDDVLAGVVRARAHGQLPNMRAIVGFAAETGDANGDVLFHARAKLRRKGCDLLVVNAVGEGRAFEVDSNDGWLLASDGTESALQHGSKTLMASRIVDAIVTFLAGCSS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant