Gene ML0554
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable ribulose-phosphate 3-epimerase Rpe |
| Comments | ML0554, len: 224 aa. Probable rpe, ribulose-phosphate 3-epimerase (EC 5.1.3.1), highly similar to RPE_MYCTU|P71676|Rv1408 rpe, ribulose-phosphate 3-epimerase from M. tuberculosis (232 aa), Fasta scores: E(): 0, (91.0% identity in 221 aa overlap); and CAD94304|Mb1443 from M. bovis (232 aa). Similar to many e.g. Q9L0Z5|RPE_STRCO Ribulose-phosphate 3-epimerase from Streptomyces coelicolor (228 aa), E(): 3.8e-54, (60.731% identity in 219 aa overlap). Contains Pfam match to entry PF00834 Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family. Contains PS01085 Ribulose-phosphate 3-epimerase family signature 1. Contains PS01086 Ribulose-phosphate 3-epimerase family signature 2. Belongs to the Ribulose-phosphate 3-epimerase family |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 671417 | 672091 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0554|rpe
MGPLIAPSILAADFARLTDEAAVVASADWLHVDVMDGHFVPNLTIGLPVVQSLLAASDIPMDCHLMIDNPDRWAPPYAEAGAYNVTFHAEATDNPVGVAHDIRTAGAKAGIGVKPGTPLNPYLDILPHFDTLLIMSVEPGFGGQAFIPEVLSKVRTVRKMVDAGELTILVEIDGGINADTIEQAAEAGVDCFVAGSAVYGAADPSAAVAALRRRAGAVSPHLRR
Bibliography
No article yet recorded