Gene Rv1408
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the calvin cycle [catalytic activity: D-ribulose 5-phosphate = D-xylulose 5- phosphate] |
| Product | Probable ribulose-phosphate 3-epimerase Rpe (PPE) (R5P3E) (pentose-5-phosphate 3-epimerase) |
| Comments | Rv1408, (MTCY21B4.25), len: 232 aa. Probable rpe, ribulose-phosphate 3-epimerase, similar to many e.g. CXEC_ALCEU|P40117 (241 aa), FASTA scores: opt: 638, E(): 1.5e-34, (48.3% identity in 234 aa overlap); and RPE_ECOLI|P32661 ribulose-phosphate 3-epimerase (225 aa), FASTA scores: E(): 0, (46.2% identity in 221 aa overlap). Contains PS01085 Ribulose-phosphate 3-epimerase family signature 1. Belongs to the ribulose-phosphate 3-epimerase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1584499 | 1585197 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1408|rpe
VSLMAGSTGGPLIAPSILAADFARLADEAAAVNGADWLHVDVMDGHFVPNLTIGLPVVESLLAVTDIPMDCHLMIDNPDRWAPPYAEAGAYNVTFHAEATDNPVGVARDIRAAGAKAGISVKPGTPLEPYLDILPHFDTLLVMSVEPGFGGQRFIPEVLSKVRAVRKMVDAGELTILVEIDGGINDDTIEQAAEAGVDCFVAGSAVYGADDPAAAVAALRRQAGAASLHLSL
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
