Gene ML0577
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable protein-export membrane protein (Translocase subunit) SecG |
| Comments | ML0577, len: 77 aa. Probable secG, protein-export membrane protein (translocase subunit) (see citation below), highly similar to SECG_MYCTU|O06819|Rv1440 secG, probable protein-export membrane protein from M. tuberculosis (77 aa), Fasta scores: E(): 1.1e-25, (96.1% identity in 77 aa overlap); and CAD96142|Mb1475 from M. bovis (77 aa). Similar to many e.g. Q9Z521|SECG_STRCO Protein-export membrane protein from Streptomyces coelicolor (102 aa), fasta scores: E(): 3.9e-12, (53.425% identity in 73 aa overlap). Previously sequenced as SECG_MYCLE|P38388 (77 aa), Fasta scores: E(): 3.1e-26, (100.0% identity in 77 aa overlap). Contains hydrophobic, possible membrane-spanning regions. Part of the prokaryotic protein translocation apparatus which comprises SecA1|ML0799, SecA2|ML2082c, SecD|ML0487, secG|ML0577, SecE|ML1907, SecF|ML0488 and SecY|ML1833. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 699951 | 700184 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0577|secG
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVTGIWLVSIIGVALLTKYR
Bibliography
No article yet recorded
